Lineage for d1ggsa_ (1ggs A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2710066Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. 2710067Superfamily a.39.1: EF-hand [47473] (12 families) (S)
    Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop
  5. 2710548Family a.39.1.5: Calmodulin-like [47502] (24 proteins)
    Duplication: made with two pairs of EF-hands
  6. 2711203Protein automated matches [190064] (21 species)
    not a true protein
  7. 2711217Species Chicken (Gallus gallus) [TaxId:9031] [187205] (3 PDB entries)
  8. 2711220Domain d1ggsa_: 1ggs A: [302426]
    automated match to d1sbja_
    complexed with ca

Details for d1ggsa_

PDB Entry: 1ggs (more details)

PDB Description: nmr structure of the c terminal domain of cardiac troponin c bound to the n terminal domain of cardiac troponin i.
PDB Compounds: (A:) protein (troponin c)

SCOPe Domain Sequences for d1ggsa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ggsa_ a.39.1.5 (A:) automated matches {Chicken (Gallus gallus) [TaxId: 9031]}
mvrcmkddskgkteeelsdlfrmfdknadgyidleelkimlqatgetiteddieelmkdg
dknndgridydeflefmkgve

SCOPe Domain Coordinates for d1ggsa_:

Click to download the PDB-style file with coordinates for d1ggsa_.
(The format of our PDB-style files is described here.)

Timeline for d1ggsa_: