![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.32: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54592] (1 superfamily) beta-alpha-beta(3); 2 layers: alpha/beta |
![]() | Superfamily d.32.1: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54593] (11 families) ![]() |
![]() | Family d.32.1.3: Extradiol dioxygenases [54602] (5 proteins) duplication: consists of 2 similar domains with 2 repeats in each Similar to the Methylmalonyl-CoA epimerase dimer |
![]() | Protein automated matches [276310] (2 species) not a true protein |
![]() | Species Pseudomonas sp. [311137] (1 PDB entry) |
![]() | Domain d1gdga4: 1gdg A:133-288 [302422] automated match to d1kw3b2 complexed with bpy, fe2, no |
PDB Entry: 1gdg (more details), 2 Å
SCOPe Domain Sequences for d1gdga4:
Sequence; same for both SEQRES and ATOM records: (download)
>d1gdga4 d.32.1.3 (A:133-288) automated matches {Pseudomonas sp.} vsgfvtgdqgighfvrcvpdtakamafytevlgfvlsdiidiqmgpetsvpahflhcngr hhtialaafpipkrihhfmlqantiddvgyafdrldaagritsllgrhtndqtlsfyadt pspmievefgwgprtvdsswtvarhsrtamwghksv
Timeline for d1gdga4: