Lineage for d1gdga4 (1gdg A:133-288)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2942376Fold d.32: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54592] (1 superfamily)
    beta-alpha-beta(3); 2 layers: alpha/beta
  4. 2942377Superfamily d.32.1: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54593] (11 families) (S)
  5. 2942540Family d.32.1.3: Extradiol dioxygenases [54602] (5 proteins)
    duplication: consists of 2 similar domains with 2 repeats in each
    Similar to the Methylmalonyl-CoA epimerase dimer
  6. 2942814Protein automated matches [276310] (2 species)
    not a true protein
  7. 2942818Species Pseudomonas sp. [311137] (1 PDB entry)
  8. 2942820Domain d1gdga4: 1gdg A:133-288 [302422]
    automated match to d1kw3b2
    complexed with bpy, fe2, no

Details for d1gdga4

PDB Entry: 1gdg (more details), 2 Å

PDB Description: crystal structure of 2,3-dihydroxybiphenyl 1,2-dioxygenase in complex with 2,3-dhbp and no
PDB Compounds: (A:) biphenyl-2,3-diol 1,2-dioxygenase

SCOPe Domain Sequences for d1gdga4:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gdga4 d.32.1.3 (A:133-288) automated matches {Pseudomonas sp.}
vsgfvtgdqgighfvrcvpdtakamafytevlgfvlsdiidiqmgpetsvpahflhcngr
hhtialaafpipkrihhfmlqantiddvgyafdrldaagritsllgrhtndqtlsfyadt
pspmievefgwgprtvdsswtvarhsrtamwghksv

SCOPe Domain Coordinates for d1gdga4:

Click to download the PDB-style file with coordinates for d1gdga4.
(The format of our PDB-style files is described here.)

Timeline for d1gdga4:

View in 3D
Domains from same chain:
(mouse over for more information)
d1gdga3