SCOPe 2.08: Domain d1gcxa3: 1gcx A:1-347

Lineage for d1gcxa3 (1gcx A:1-347)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.3: Ribonuclease H-like [53098] (18 families)
   consists of one domain of this fold

5. Family c.55.3.0: automated matches [191357] (1 protein)
   not a true family

6. Protein automated matches [190396] (40 species)
   not a true protein

7. Species Pyrococcus kodakaraensis [TaxId:69014] [311138] (1 PDB entry)

8. Domain d1gcxa3: 1gcx A:1-347 [302419]
   Other proteins in same PDB: d1gcxa4
   automated match to d3a2fa1

Details for d1gcxa3

PDB Entry: 1gcx, 3 Å

PDB Description: crystal structure of family b dna polymerase from hyperthermophilic archaeon pyrococcus kodakaraensis kod1

PDB Compounds: (A:) DNA polymerase

SCOPe Domain Sequences for d1gcxa3:

Sequence; same for both SEQRES and ATOM records:

>d1gcxa3 c.55.3.0 (A:1-347) automated matches {Pyrococcus kodakaraensis [TaxId: 69014]}
mildtdyitedgkpvirifkkengefkieydrtfepyfyallkddsaieevkkitaerhg
tvvtvkrvekvqkkflgrpvevwklyfthpqdvpairdkirehpavidiyeydipfakry
lidkglvpmegdeelkmlafdietlyhegeefaegpilmisyadeegarvitwknvdlpy
vdvvsteremikrflrvvkekdpdvlityngdnfdfaylkkrceklginfalgrdgsepk
iqrmgdrfavevkgrihfdlypvirrtinlptytleavyeavfgqpkekvyaeeittawe
tgenlervarysmedakvtyelgkeflpmeaqlsrligqslwdvsrs

Timeline for d1gcxa3:

• d1gcxa3 first appeared in SCOPe 2.06
  
• d1gcxa3 appears in SCOPe 2.07