| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families) ![]() contains a small beta-sheet (wing) |
| Family a.4.5.28: MarR-like transcriptional regulators [63379] (20 proteins) The N- and C-terminal helical extensions to the common fold form the dimer interface |
| Protein automated matches [190294] (6 species) not a true protein |
| Species Staphylococcus aureus [311136] (1 PDB entry) |
| Domain d1fznd_: 1fzn D: [302416] automated match to d2frha_ |
PDB Entry: 1fzn (more details), 2.55 Å
SCOPe Domain Sequences for d1fznd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fznd_ a.4.5.28 (D:) automated matches {Staphylococcus aureus}
indcfellsmvtyadklkslikkefsisfeefavltyisenkekeyylkdiinhlnykqp
qvvkavkilsqedyfdkkrnehdertvlimvnaqqrkkiesllsrvnkriteanne
Timeline for d1fznd_: