Lineage for d1fznd_ (1fzn D:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2691777Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2692959Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families) (S)
    contains a small beta-sheet (wing)
  5. 2693716Family a.4.5.28: MarR-like transcriptional regulators [63379] (20 proteins)
    The N- and C-terminal helical extensions to the common fold form the dimer interface
  6. 2693816Protein automated matches [190294] (6 species)
    not a true protein
  7. 2693833Species Staphylococcus aureus [311136] (1 PDB entry)
  8. 2693834Domain d1fznd_: 1fzn D: [302416]
    automated match to d2frha_

Details for d1fznd_

PDB Entry: 1fzn (more details), 2.55 Å

PDB Description: crystal structures of sara: a pleiotropic regulator of virulence genes in s. aureus
PDB Compounds: (D:) Staphylococcal accessory regulator A

SCOPe Domain Sequences for d1fznd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fznd_ a.4.5.28 (D:) automated matches {Staphylococcus aureus}
indcfellsmvtyadklkslikkefsisfeefavltyisenkekeyylkdiinhlnykqp
qvvkavkilsqedyfdkkrnehdertvlimvnaqqrkkiesllsrvnkriteanne

SCOPe Domain Coordinates for d1fznd_:

Click to download the PDB-style file with coordinates for d1fznd_.
(The format of our PDB-style files is described here.)

Timeline for d1fznd_: