Lineage for d1fvza_ (1fvz A:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2581738Fold d.129: TBP-like [55944] (11 superfamilies)
    beta-alpha-beta(4)-alpha
  4. 2582036Superfamily d.129.3: Bet v1-like [55961] (11 families) (S)
    contains a single copy of this fold with a alpha-beta2 insertion after the first helix; there is a cavity between the beta-sheet and the long C-terminal helix
  5. 2582321Family d.129.3.4: Phoshatidylinositol transfer protein, PITP [64388] (2 proteins)
    automatically mapped to Pfam PF02121
  6. 2582334Protein automated matches [310838] (1 species)
    not a true protein
  7. 2582335Species Rattus norvegicus [311135] (1 PDB entry)
  8. 2582336Domain d1fvza_: 1fvz A: [302414]
    automated match to d1uw5a_
    complexed with pc2

Details for d1fvza_

PDB Entry: 1fvz (more details), 2.2 Å

PDB Description: the structure of pitp complexed to phosphatidylcholine
PDB Compounds: (A:) phosphatidylinositol transfer protein

SCOPe Domain Sequences for d1fvza_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fvza_ d.129.3.4 (A:) automated matches {Rattus norvegicus}
vllkeyrvilpvsvdeyqvgqlysvaeasknetgggegvevlvnepyekddgekgqythk
iyhlqskvptfvrmlapegalnihekawnaypycrtvitneymkedflikietwhkpdlg
tqenvhklepeawkhveviyidiadrsqvlskdykaeedpakfksiktgrgplgpnwkqe
lvnqkdcpymcayklvtvkfkwwglqnkvenfihkqekrlftnfhrqlfcwldkwvdltm
ddirrmeeetkrqldemrqkdpvkgmtad

SCOPe Domain Coordinates for d1fvza_:

Click to download the PDB-style file with coordinates for d1fvza_.
(The format of our PDB-style files is described here.)

Timeline for d1fvza_: