Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.129: TBP-like [55944] (11 superfamilies) beta-alpha-beta(4)-alpha |
Superfamily d.129.3: Bet v1-like [55961] (11 families) contains a single copy of this fold with a alpha-beta2 insertion after the first helix; there is a cavity between the beta-sheet and the long C-terminal helix |
Family d.129.3.4: Phoshatidylinositol transfer protein, PITP [64388] (2 proteins) automatically mapped to Pfam PF02121 |
Protein automated matches [310838] (1 species) not a true protein |
Species Rattus norvegicus [311135] (1 PDB entry) |
Domain d1fvza_: 1fvz A: [302414] automated match to d1uw5a_ complexed with pc2 |
PDB Entry: 1fvz (more details), 2.2 Å
SCOPe Domain Sequences for d1fvza_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fvza_ d.129.3.4 (A:) automated matches {Rattus norvegicus} vllkeyrvilpvsvdeyqvgqlysvaeasknetgggegvevlvnepyekddgekgqythk iyhlqskvptfvrmlapegalnihekawnaypycrtvitneymkedflikietwhkpdlg tqenvhklepeawkhveviyidiadrsqvlskdykaeedpakfksiktgrgplgpnwkqe lvnqkdcpymcayklvtvkfkwwglqnkvenfihkqekrlftnfhrqlfcwldkwvdltm ddirrmeeetkrqldemrqkdpvkgmtad
Timeline for d1fvza_: