SCOPe 2.06: Domain d1fvza_: 1fvz A:

Lineage for d1fvza_ (1fvz A:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.129: TBP-like [55944] (11 superfamilies)
   beta-alpha-beta(4)-alpha

4. Superfamily d.129.3: Bet v1-like [55961] (11 families)
   contains a single copy of this fold with a alpha-beta2 insertion after the first helix; there is a cavity between the beta-sheet and the long C-terminal helix

5. Family d.129.3.4: Phoshatidylinositol transfer protein, PITP [64388] (2 proteins)
   automatically mapped to Pfam PF02121

6. Protein automated matches [310838] (1 species)
   not a true protein

7. Species Rattus norvegicus [311135] (1 PDB entry)

8. Domain d1fvza_: 1fvz A: [302414]
   automated match to d1uw5a_
   complexed with pc2

Details for d1fvza_

PDB Entry: 1fvz, 2.2 Å

PDB Description: the structure of pitp complexed to phosphatidylcholine

PDB Compounds: (A:) phosphatidylinositol transfer protein

SCOPe Domain Sequences for d1fvza_:

Sequence; same for both SEQRES and ATOM records:

>d1fvza_ d.129.3.4 (A:) automated matches {Rattus norvegicus}
vllkeyrvilpvsvdeyqvgqlysvaeasknetgggegvevlvnepyekddgekgqythk
iyhlqskvptfvrmlapegalnihekawnaypycrtvitneymkedflikietwhkpdlg
tqenvhklepeawkhveviyidiadrsqvlskdykaeedpakfksiktgrgplgpnwkqe
lvnqkdcpymcayklvtvkfkwwglqnkvenfihkqekrlftnfhrqlfcwldkwvdltm
ddirrmeeetkrqldemrqkdpvkgmtad

Timeline for d1fvza_:

• d1fvza_ is new in SCOPe 2.06-stable
  
• d1fvza_ appears in SCOPe 2.07
  
• d1fvza_ appears in the current release, SCOPe 2.08