SCOPe 2.07: Domain d1fe7b_: 1fe7 B:

Lineage for d1fe7b_ (1fe7 B:)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily)
   common core: 2 helices, disulfide-linked, and a calcium-binding loop

4. Superfamily a.133.1: Phospholipase A2, PLA2 [48619] (4 families)

5. Family a.133.1.2: Vertebrate phospholipase A2 [48623] (3 proteins)
   automatically mapped to Pfam PF00068

6. Protein Snake phospholipase A2 [48624] (38 species)

7. Species Snake (Daboia russellii pulchella), different isoforms [TaxId:97228] [48630] (39 PDB entries)
   Uniprot P59071

8. Domain d1fe7b_: 1fe7 B: [302411]
   automated match to d1tk4a_
   complexed with acy, co3, vit

Details for d1fe7b_

PDB Entry: 1fe7, 1.8 Å

PDB Description: first structural evidence of anti-inflammatory action of vitamin e (2,5,7,8-tetramethyl-2-(4',8',12'-trimethyltridecyl)-6-chromanol) through its binding to phospholipase a2 specifically: crystal structure of a complex formed between phospholipase a2 and vitamin e at 1.80 resolution

PDB Compounds: (B:) phospholipase a2

SCOPe Domain Sequences for d1fe7b_:

Sequence; same for both SEQRES and ATOM records:

>d1fe7b_ a.133.1.2 (B:) Snake phospholipase A2 {Snake (Daboia russellii pulchella), different isoforms [TaxId: 97228]}
sllefgkmileetgklaipsyssygcycgwggkgtpkdatdrccfvhdccygnlpdcnpk
sdrykykrvngaivcekgtscenricecdkaaaicfrqnlntyskkymlypdflckgelk
c

Timeline for d1fe7b_:

• d1fe7b_ first appeared in SCOPe 2.06
  
• d1fe7b_ appears in the current release, SCOPe 2.08