Lineage for d1fe7a_ (1fe7 A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2338840Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily)
    common core: 2 helices, disulfide-linked, and a calcium-binding loop
  4. 2338841Superfamily a.133.1: Phospholipase A2, PLA2 [48619] (4 families) (S)
  5. 2338846Family a.133.1.2: Vertebrate phospholipase A2 [48623] (3 proteins)
    automatically mapped to Pfam PF00068
  6. 2338958Protein Snake phospholipase A2 [48624] (38 species)
  7. 2339157Species Snake (Daboia russellii pulchella), different isoforms [TaxId:97228] [48630] (39 PDB entries)
    Uniprot P59071
  8. 2339178Domain d1fe7a_: 1fe7 A: [302410]
    automated match to d1tk4a_
    complexed with acy, co3, vit

Details for d1fe7a_

PDB Entry: 1fe7 (more details), 1.8 Å

PDB Description: first structural evidence of anti-inflammatory action of vitamin e (2,5,7,8-tetramethyl-2-(4',8',12'-trimethyltridecyl)-6-chromanol) through its binding to phospholipase a2 specifically: crystal structure of a complex formed between phospholipase a2 and vitamin e at 1.80 resolution
PDB Compounds: (A:) phospholipase a2

SCOPe Domain Sequences for d1fe7a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fe7a_ a.133.1.2 (A:) Snake phospholipase A2 {Snake (Daboia russellii pulchella), different isoforms [TaxId: 97228]}
sllefgkmileetgklaipsyssygcycgwggkgtpkdatdrccfvhdccygnlpdcnpk
sdrykykrvngaivcekgtscenricecdkaaaicfrqnlntyskkymlypdflckgelk
c

SCOPe Domain Coordinates for d1fe7a_:

Click to download the PDB-style file with coordinates for d1fe7a_.
(The format of our PDB-style files is described here.)

Timeline for d1fe7a_: