SCOP 1.67: Domain d2tmgd1: 2tmg D:179-411

Lineage for d2tmgd1 (2tmg D:179-411)

1. Root: SCOP 1.67

2. Class c: Alpha and beta proteins (a/b) [51349] (130 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (11 families)

5. Family c.2.1.7: Aminoacid dehydrogenase-like, C-terminal domain [51883] (10 proteins)
   extra N-terminal helix displaces the C-terminal helix (following strand 6) from its usual position creating a family nicotineamide-binding site

6. Protein Glutamate dehydrogenase [51884] (7 species)

7. Species Thermotoga maritima [TaxId:243274] [51888] (3 PDB entries)

8. Domain d2tmgd1: 2tmg D:179-411 [30241]
   Other proteins in same PDB: d2tmga2, d2tmgb2, d2tmgc2, d2tmgd2, d2tmge2, d2tmgf2

Details for d2tmgd1

PDB Entry: 2tmg, 2.9 Å

PDB Description: thermotoga maritima glutamate dehydrogenase mutant s128r, t158e, n117r, s160e

SCOP Domain Sequences for d2tmgd1:

Sequence; same for both SEQRES and ATOM records:

>d2tmgd1 c.2.1.7 (D:179-411) Glutamate dehydrogenase {Thermotoga maritima}
ggskgreeatgrgvkvcaglamdvlgidpkkatvavqgfgnvgqfaallisqelgskvva
vsdsrggiynpegfdveelirykkehgtvvtypkgeritneelleldvdilvpaalegai
hagnaerikakavvegangpttpeadeilsrrgilvvpdilanaggvtvsyfewvqdlqs
ffwdldqvrnalekmmkgafndvmkvkekynvdmrtaayilaidrvayatkkr

Timeline for d2tmgd1:

• d2tmgd1 first appeared (with stable ids) in SCOP 1.55
  
• d2tmgd1 appears in SCOP 1.65
  
• d2tmgd1 appears in SCOP 1.69
  
• d2tmgd1 appears in the current release, SCOPe 2.08