Lineage for d2tmgd1 (2tmg D:179-411)

  1. Root: SCOP 1.65
  2. 305035Class c: Alpha and beta proteins (a/b) [51349] (121 folds)
  3. 307887Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 307888Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (10 families) (S)
  5. 309102Family c.2.1.7: Aminoacid dehydrogenase-like, C-terminal domain [51883] (10 proteins)
    extra N-terminal helix displaces the C-terminal helix (following strand 6) from its usual position creating a family nicotineamide-binding site
  6. 309103Protein Glutamate dehydrogenase [51884] (7 species)
  7. 309185Species Thermotoga maritima [TaxId:243274] [51888] (3 PDB entries)
  8. 309195Domain d2tmgd1: 2tmg D:179-411 [30241]
    Other proteins in same PDB: d2tmga2, d2tmgb2, d2tmgc2, d2tmgd2, d2tmge2, d2tmgf2

Details for d2tmgd1

PDB Entry: 2tmg (more details), 2.9 Å

PDB Description: thermotoga maritima glutamate dehydrogenase mutant s128r, t158e, n117r, s160e

SCOP Domain Sequences for d2tmgd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2tmgd1 c.2.1.7 (D:179-411) Glutamate dehydrogenase {Thermotoga maritima}
ggskgreeatgrgvkvcaglamdvlgidpkkatvavqgfgnvgqfaallisqelgskvva
vsdsrggiynpegfdveelirykkehgtvvtypkgeritneelleldvdilvpaalegai
hagnaerikakavvegangpttpeadeilsrrgilvvpdilanaggvtvsyfewvqdlqs
ffwdldqvrnalekmmkgafndvmkvkekynvdmrtaayilaidrvayatkkr

SCOP Domain Coordinates for d2tmgd1:

Click to download the PDB-style file with coordinates for d2tmgd1.
(The format of our PDB-style files is described here.)

Timeline for d2tmgd1: