Class b: All beta proteins [48724] (177 folds) |
Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies) barrel, closed; n=6, S=10; greek-key |
Superfamily b.43.4: Riboflavin synthase domain-like [63380] (4 families) |
Family b.43.4.2: Ferredoxin reductase FAD-binding domain-like [63381] (10 proteins) coupled with a NADP-binding domain of alpha/beta class |
Protein Ferredoxin reductase (flavodoxin reductase) N-terminal domain [50415] (9 species) |
Species Paprika (Capsicum annuum) [TaxId:4072] [50418] (2 PDB entries) |
Domain d1fb3b3: 1fb3 B:1067-1207 [302408] Other proteins in same PDB: d1fb3a4, d1fb3b4 automated match to d1sm4a1 complexed with fad, po4 |
PDB Entry: 1fb3 (more details), 2.5 Å
SCOPe Domain Sequences for d1fb3b3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fb3b3 b.43.4.2 (B:1067-1207) Ferredoxin reductase (flavodoxin reductase) N-terminal domain {Paprika (Capsicum annuum) [TaxId: 4072]} iskkqdegvvvnkfrpkepyigrcllntkitgddapgetwhmvfstegeipyregqsigv iadgvdangkphklrlysiassalgdfgdsktvslcvkrlvytndkgeevkgvcsnflcd lkpgadvkitgpvgkemlmpk
Timeline for d1fb3b3: