SCOPe 2.06: Domain d1fb3b3: 1fb3 B:1067-1207

Lineage for d1fb3b3 (1fb3 B:1067-1207)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies)
   barrel, closed; n=6, S=10; greek-key

4. Superfamily b.43.4: Riboflavin synthase domain-like [63380] (4 families)

5. Family b.43.4.2: Ferredoxin reductase FAD-binding domain-like [63381] (10 proteins)
   coupled with a NADP-binding domain of alpha/beta class

6. Protein Ferredoxin reductase (flavodoxin reductase) N-terminal domain [50415] (9 species)

7. Species Paprika (Capsicum annuum) [TaxId:4072] [50418] (2 PDB entries)

8. Domain d1fb3b3: 1fb3 B:1067-1207 [302408]
   Other proteins in same PDB: d1fb3a4, d1fb3b4
   automated match to d1sm4a1
   complexed with fad, po4

Details for d1fb3b3

PDB Entry: 1fb3, 2.5 Å

PDB Description: crystal structure analysis of the ferredoxin-nadp+ reductase from paprika

PDB Compounds: (B:) chloroplast ferredoxin-NADP+ oxidoreductase

SCOPe Domain Sequences for d1fb3b3:

Sequence; same for both SEQRES and ATOM records:

>d1fb3b3 b.43.4.2 (B:1067-1207) Ferredoxin reductase (flavodoxin reductase) N-terminal domain {Paprika (Capsicum annuum) [TaxId: 4072]}
iskkqdegvvvnkfrpkepyigrcllntkitgddapgetwhmvfstegeipyregqsigv
iadgvdangkphklrlysiassalgdfgdsktvslcvkrlvytndkgeevkgvcsnflcd
lkpgadvkitgpvgkemlmpk

Timeline for d1fb3b3:

• d1fb3b3 is new in SCOPe 2.06-stable
  
• d1fb3b3 appears in SCOPe 2.07
  
• d1fb3b3 appears in the current release, SCOPe 2.08