SCOPe 2.06: Domain d1f5ib_: 1f5i B:

Lineage for d1f5ib_ (1f5i B:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.80: Single-stranded right-handed beta-helix [51125] (8 superfamilies)
   superhelix turns are made of parallel beta-strands and (short) turns

4. Superfamily b.80.5: C-terminal domain of adenylylcyclase associated protein [69340] (2 families)
   superhelix turns are made of two strands each
   automatically mapped to Pfam PF08603

5. Family b.80.5.0: automated matches [254213] (1 protein)
   not a true family

6. Protein automated matches [254480] (2 species)
   not a true protein

7. Species Saccharomyces cerevisiae [311134] (1 PDB entry)

8. Domain d1f5ib_: 1f5i B: [302404]
   automated match to d1k8fa_

Details for d1f5ib_

PDB Entry: 1f5i, 2.3 Å

PDB Description: c-terminal domain of cyclase-associated protein

PDB Compounds: (B:) Adenylyl cyclase-associated protein

SCOPe Domain Sequences for d1f5ib_:

Sequence; same for both SEQRES and ATOM records:

>d1f5ib_ b.80.5.0 (B:) automated matches {Saccharomyces cerevisiae}
pprkelvgnkwfienyeneteslvidankdesifigkcsqvlvqikgkvnaislsetesc
svvldssisgmdviksnkfgiqvnhslpqisidksdggniylskeslnteiytscstain
vnlpigedddyvefpipeqmkhsfadgkfksavfe

Timeline for d1f5ib_:

• d1f5ib_ is new in SCOPe 2.06-stable
  
• d1f5ib_ appears in SCOPe 2.07
  
• d1f5ib_ appears in the current release, SCOPe 2.08