![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.32: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54592] (1 superfamily) beta-alpha-beta(3); 2 layers: alpha/beta |
![]() | Superfamily d.32.1: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54593] (11 families) ![]() |
![]() | Family d.32.1.3: Extradiol dioxygenases [54602] (5 proteins) duplication: consists of 2 similar domains with 2 repeats in each Similar to the Methylmalonyl-CoA epimerase dimer |
![]() | Protein Homoprotocatechuate 2,3-dioxygenase [89886] (2 species) |
![]() | Species Brevibacterium fuscum [TaxId:47914] [89888] (17 PDB entries) |
![]() | Domain d1f1yb2: 1f1y B:148-359 [302401] automated match to d1q0oa2 complexed with dhy, of3 |
PDB Entry: 1f1y (more details), 2.3 Å
SCOPe Domain Sequences for d1f1yb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1f1yb2 d.32.1.3 (B:148-359) Homoprotocatechuate 2,3-dioxygenase {Brevibacterium fuscum [TaxId: 47914]} gelvrldhfnqvtpdvprgrkyledlgfrvtediqddegttyaawmhrkgtvhdtaltgg ngprlhhvafsthekhniiqicdkmgalrisdriergpgrhgvsnafylyildpdnhrie iytqdyytgdpdnptitwnvhdnqrrdwwgnpvvpswyteaskvldldgnvqeiiertdd selevtigadgfsftragdedgsyhgqaskgf
Timeline for d1f1yb2: