SCOPe 2.08: Domain d1f1yb2: 1f1y B:148-359

Lineage for d1f1yb2 (1f1y B:148-359)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.32: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54592] (1 superfamily)
   beta-alpha-beta(3); 2 layers: alpha/beta

4. Superfamily d.32.1: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54593] (11 families)

5. Family d.32.1.3: Extradiol dioxygenases [54602] (5 proteins)
   duplication: consists of 2 similar domains with 2 repeats in each
   Similar to the Methylmalonyl-CoA epimerase dimer

6. Protein Homoprotocatechuate 2,3-dioxygenase [89886] (2 species)

7. Species Brevibacterium fuscum [TaxId:47914] [89888] (17 PDB entries)

8. Domain d1f1yb2: 1f1y B:148-359 [302401]
   automated match to d1q0oa2
   complexed with dhy, of3

Details for d1f1yb2

PDB Entry: 1f1y, 2.3 Å

PDB Description: crystal structure of homoprotocatechuate 2,3-dioxygenase from brevibacterium fuscum (full length protein)

PDB Compounds: (B:) homoprotocatechuate 2,3-dioxygenase

SCOPe Domain Sequences for d1f1yb2:

Sequence; same for both SEQRES and ATOM records:

>d1f1yb2 d.32.1.3 (B:148-359) Homoprotocatechuate 2,3-dioxygenase {Brevibacterium fuscum [TaxId: 47914]}
gelvrldhfnqvtpdvprgrkyledlgfrvtediqddegttyaawmhrkgtvhdtaltgg
ngprlhhvafsthekhniiqicdkmgalrisdriergpgrhgvsnafylyildpdnhrie
iytqdyytgdpdnptitwnvhdnqrrdwwgnpvvpswyteaskvldldgnvqeiiertdd
selevtigadgfsftragdedgsyhgqaskgf

Timeline for d1f1yb2:

• d1f1yb2 first appeared in SCOPe 2.06
  
• d1f1yb2 appears in SCOPe 2.07