Lineage for d1f1ya1 (1f1y A:4-147)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2186669Fold d.32: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54592] (1 superfamily)
    beta-alpha-beta(3); 2 layers: alpha/beta
  4. 2186670Superfamily d.32.1: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54593] (11 families) (S)
  5. 2186831Family d.32.1.3: Extradiol dioxygenases [54602] (5 proteins)
    duplication: consists of 2 similar domains with 2 repeats in each
    Similar to the Methylmalonyl-CoA epimerase dimer
  6. 2186926Protein Homoprotocatechuate 2,3-dioxygenase [89886] (2 species)
  7. 2186940Species Brevibacterium fuscum [TaxId:47914] [89888] (17 PDB entries)
  8. 2187053Domain d1f1ya1: 1f1y A:4-147 [302398]
    automated match to d1q0oa1
    complexed with dhy, of3

Details for d1f1ya1

PDB Entry: 1f1y (more details), 2.3 Å

PDB Description: crystal structure of homoprotocatechuate 2,3-dioxygenase from brevibacterium fuscum (full length protein)
PDB Compounds: (A:) homoprotocatechuate 2,3-dioxygenase

SCOPe Domain Sequences for d1f1ya1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1f1ya1 d.32.1.3 (A:4-147) Homoprotocatechuate 2,3-dioxygenase {Brevibacterium fuscum [TaxId: 47914]}
eipkpvapapdilrcayaelvvtdlaksrnfyvdvlglhvsyedenqiylrsfeefihhn
lvltkgpvaalkamafrvrtpedvdkaeayyqelgcrterrkdgfvkgigdalrvedplg
fpyefffetthverlhmrydlysa

SCOPe Domain Coordinates for d1f1ya1:

Click to download the PDB-style file with coordinates for d1f1ya1.
(The format of our PDB-style files is described here.)

Timeline for d1f1ya1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1f1ya2