![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.57: DNA damage-inducible protein DinI [54856] (1 superfamily) beta-alpha-beta(2)-alpha; 2 layers: alpha/beta; mixed sheet 213; crossing loops |
![]() | Superfamily d.57.1: DNA damage-inducible protein DinI [54857] (1 family) ![]() automatically mapped to Pfam PF06183 |
![]() | Family d.57.1.1: DNA damage-inducible protein DinI [54858] (1 protein) |
![]() | Protein DNA damage-inducible protein DinI [54859] (1 species) |
![]() | Species Escherichia coli [TaxId:562] [54860] (3 PDB entries) |
![]() | Domain d1f0aa_: 1f0a A: [302397] automated match to d1ghha_ |
PDB Entry: 1f0a (more details)
SCOPe Domain Sequences for d1f0aa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1f0aa_ d.57.1.1 (A:) DNA damage-inducible protein DinI {Escherichia coli [TaxId: 562]} mrievtiaktsplpagaidalagelsrriqyafpdneghvsvryaaannlsvigatkedk qriseilqetwesaddwfvse
Timeline for d1f0aa_: