Lineage for d1ewgd_ (1ewg D:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2834402Superfamily c.1.10: Aldolase [51569] (9 families) (S)
    Common fold covers whole protein structure
  5. 2834403Family c.1.10.1: Class I aldolase [51570] (13 proteins)
    the catalytic lysine forms schiff-base intermediate with substrate
    possible link between the aldolase superfamily and the phosphate-binding beta/alpha barrels
  6. 2834988Protein automated matches [190095] (28 species)
    not a true protein
  7. 2835201Species Oryctolagus cuniculus [311133] (1 PDB entry)
  8. 2835205Domain d1ewgd_: 1ewg D: [302396]
    automated match to d1ewda_

Details for d1ewgd_

PDB Entry: 1ewg (more details), 2 Å

PDB Description: fructose 1,6-bisphosphate aldolase from rabbit muscle
PDB Compounds: (D:) fructose 1,6-bisphosphate aldolase

SCOPe Domain Sequences for d1ewgd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ewgd_ c.1.10.1 (D:) automated matches {Oryctolagus cuniculus}
phshpaltpeqkkelsdiahrivapgkgilaadestgsiakrlqsigtenteenrrfyrq
llltaddrvnpciggvilfhetlyqkaddgrpfpqvikskggvvgikvdkgvvplagtng
etttqgldglsercaqykkdgadfakwrcvlkigehtpsalaimenanvlaryasicqqn
givpivqpeilpdgdhdlkrcqyvtekvlaavykalsdhhiylegtllkpnmvtpghact
qkysheeiamatvtalrrtvppavtgvtflsggqseeeasinlnainkcpllkpwaltfs
ygralqasalkawggkkenlkaaqeeyvkralanslacqgkytpsgqagaaaseslfisn
hay

SCOPe Domain Coordinates for d1ewgd_:

Click to download the PDB-style file with coordinates for d1ewgd_.
(The format of our PDB-style files is described here.)

Timeline for d1ewgd_: