Lineage for d1ewga_ (1ewg A:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2089714Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2096922Superfamily c.1.10: Aldolase [51569] (9 families) (S)
    Common fold covers whole protein structure
  5. 2096923Family c.1.10.1: Class I aldolase [51570] (13 proteins)
    the catalytic lysine forms schiff-base intermediate with substrate
    possible link between the aldolase superfamily and the phosphate-binding beta/alpha barrels
  6. 2097472Protein automated matches [190095] (24 species)
    not a true protein
  7. 2097657Species Oryctolagus cuniculus [311133] (1 PDB entry)
  8. 2097658Domain d1ewga_: 1ewg A: [302393]
    automated match to d1ewda_

Details for d1ewga_

PDB Entry: 1ewg (more details), 2 Å

PDB Description: fructose 1,6-bisphosphate aldolase from rabbit muscle
PDB Compounds: (A:) fructose 1,6-bisphosphate aldolase

SCOPe Domain Sequences for d1ewga_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ewga_ c.1.10.1 (A:) automated matches {Oryctolagus cuniculus}
phshpaltpeqkkelsdiahrivapgkgilaadestgsiakrlqsigtenteenrrfyrq
llltaddrvnpciggvilfhetlyqkaddgrpfpqvikskggvvgikvdkgvvplagtng
etttqgldglsercaqykkdgadfakwrcvlkigehtpsalaimenanvlaryasicqqn
givpivqpeilpdgdhdlkrcqyvtekvlaavykalsdhhiylegtllkpnmvtpghact
qkysheeiamatvtalrrtvppavtgvtflsggqseeeasinlnainkcpllkpwaltfs
ygralqasalkawggkkenlkaaqeeyvkralanslacqgkytpsgqagaaaseslfisn
hay

SCOPe Domain Coordinates for d1ewga_:

Click to download the PDB-style file with coordinates for d1ewga_.
(The format of our PDB-style files is described here.)

Timeline for d1ewga_: