Lineage for d2tmgb1 (2tmg B:179-411)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2841004Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2841005Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2845190Family c.2.1.7: Aminoacid dehydrogenase-like, C-terminal domain [51883] (12 proteins)
    extra N-terminal helix displaces the C-terminal helix (following strand 6) from its usual position creating a family nicotineamide-binding site
  6. 2845191Protein Glutamate dehydrogenase [51884] (8 species)
  7. 2845283Species Thermotoga maritima [TaxId:2336] [51888] (3 PDB entries)
  8. 2845291Domain d2tmgb1: 2tmg B:179-411 [30239]
    Other proteins in same PDB: d2tmga2, d2tmgb2, d2tmgc2, d2tmgd2, d2tmge2, d2tmgf2
    mutant
    has additional insertions and/or extensions that are not grouped together

Details for d2tmgb1

PDB Entry: 2tmg (more details), 2.9 Å

PDB Description: thermotoga maritima glutamate dehydrogenase mutant s128r, t158e, n117r, s160e
PDB Compounds: (B:) protein (glutamate dehydrogenase)

SCOPe Domain Sequences for d2tmgb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2tmgb1 c.2.1.7 (B:179-411) Glutamate dehydrogenase {Thermotoga maritima [TaxId: 2336]}
ggskgreeatgrgvkvcaglamdvlgidpkkatvavqgfgnvgqfaallisqelgskvva
vsdsrggiynpegfdveelirykkehgtvvtypkgeritneelleldvdilvpaalegai
hagnaerikakavvegangpttpeadeilsrrgilvvpdilanaggvtvsyfewvqdlqs
ffwdldqvrnalekmmkgafndvmkvkekynvdmrtaayilaidrvayatkkr

SCOPe Domain Coordinates for d2tmgb1:

Click to download the PDB-style file with coordinates for d2tmgb1.
(The format of our PDB-style files is described here.)

Timeline for d2tmgb1: