![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
![]() | Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families) ![]() contains a small beta-sheet (wing) |
![]() | Family a.4.5.21: ets domain [46859] (9 proteins) |
![]() | Protein ETS-1 transcription factor, residues 331-440 [46862] (2 species) |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [46863] (7 PDB entries) Uniprot P27577 301-440 |
![]() | Domain d1etca_: 1etc A: [302388] automated match to d3wu1b_ has additional insertions and/or extensions that are not grouped together |
PDB Entry: 1etc (more details)
SCOPe Domain Sequences for d1etca_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1etca_ a.4.5.21 (A:) ETS-1 transcription factor, residues 331-440 {Mouse (Mus musculus) [TaxId: 10090]} iqlwqfllelltdkscqsfiswtgdgwefklsdpdevarrwgkrknkpkmnyeklsrglr yyydkniihktagkryvyrfvcdlqsllgytpeelhamldvkpdad
Timeline for d1etca_: