Lineage for d1etca_ (1etc A:)

  1. Root: SCOPe 2.08
  2. Class a: All alpha proteins [46456] (290 folds)
  3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families) (S)
    contains a small beta-sheet (wing)
  5. Family a.4.5.21: ets domain [46859] (9 proteins)
  6. Protein ETS-1 transcription factor, residues 331-440 [46862] (2 species)
  7. Species Mouse (Mus musculus) [TaxId:10090] [46863] (7 PDB entries)
    Uniprot P27577 301-440
  8. Domain d1etca_: 1etc A: [302388]
    automated match to d3wu1b_

Details for d1etca_

PDB Entry: 1etc (more details)

PDB Description: solution structure of the ets domain from murine ets-1: a winged helix-turn-helix dna binding motif
PDB Compounds: (A:) murine ets-1 transcription factor

SCOPe Domain Sequences for d1etca_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1etca_ a.4.5.21 (A:) ETS-1 transcription factor, residues 331-440 {Mouse (Mus musculus) [TaxId: 10090]}
iqlwqfllelltdkscqsfiswtgdgwefklsdpdevarrwgkrknkpkmnyeklsrglr
yyydkniihktagkryvyrfvcdlqsllgytpeelhamldvkpdad

SCOPe Domain Coordinates for d1etca_ are not available.

Timeline for d1etca_: