Lineage for d1ejka_ (1ejk A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949046Fold d.57: DNA damage-inducible protein DinI [54856] (1 superfamily)
    beta-alpha-beta(2)-alpha; 2 layers: alpha/beta; mixed sheet 213; crossing loops
  4. 2949047Superfamily d.57.1: DNA damage-inducible protein DinI [54857] (1 family) (S)
    automatically mapped to Pfam PF06183
  5. 2949048Family d.57.1.1: DNA damage-inducible protein DinI [54858] (1 protein)
  6. 2949049Protein DNA damage-inducible protein DinI [54859] (1 species)
  7. 2949050Species Escherichia coli [TaxId:562] [54860] (3 PDB entries)
  8. 2949053Domain d1ejka_: 1ejk A: [302385]
    automated match to d1ghha_

Details for d1ejka_

PDB Entry: 1ejk (more details)

PDB Description: solution structure of the dini protein
PDB Compounds: (A:) dini protein

SCOPe Domain Sequences for d1ejka_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ejka_ d.57.1.1 (A:) DNA damage-inducible protein DinI {Escherichia coli [TaxId: 562]}
mrievtiaktsplpagaidalagelsrriqyafpdneghvsvryaaannlsvigatkedk
qriseilqetwesaddwfvse

SCOPe Domain Coordinates for d1ejka_:

Click to download the PDB-style file with coordinates for d1ejka_.
(The format of our PDB-style files is described here.)

Timeline for d1ejka_: