Lineage for d1eima3 (1eim A:1-132)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2942376Fold d.32: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54592] (1 superfamily)
    beta-alpha-beta(3); 2 layers: alpha/beta
  4. 2942377Superfamily d.32.1: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54593] (11 families) (S)
  5. 2942540Family d.32.1.3: Extradiol dioxygenases [54602] (5 proteins)
    duplication: consists of 2 similar domains with 2 repeats in each
    Similar to the Methylmalonyl-CoA epimerase dimer
  6. 2942541Protein 2,3-Dihydroxybiphenyl dioxygenase (DHBD, BPHC enzyme) [54603] (2 species)
  7. 2942555Species Pseudomonas sp. [TaxId:306] [54604] (11 PDB entries)
  8. 2942568Domain d1eima3: 1eim A:1-132 [302383]
    automated match to d1eiqa1
    complexed with bpy, fe

Details for d1eima3

PDB Entry: 1eim (more details), 2 Å

PDB Description: 2,3-dihydroxybiphenyl-1,2-dioxygenase
PDB Compounds: (A:) 2,3-dihydroxybiphenyl-1,2-dioxygenase

SCOPe Domain Sequences for d1eima3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1eima3 d.32.1.3 (A:1-132) 2,3-Dihydroxybiphenyl dioxygenase (DHBD, BPHC enzyme) {Pseudomonas sp. [TaxId: 306]}
sierlgylgfavkdvpawdhfltksvglmaagsagdaalyradqrawriavqpgelddla
yaglevddaaalermadklrqagvaftrgdealmqqrkvmgllclqdpfglpleiyygpa
eifhepflpsap

SCOPe Domain Coordinates for d1eima3:

Click to download the PDB-style file with coordinates for d1eima3.
(The format of our PDB-style files is described here.)

Timeline for d1eima3:

View in 3D
Domains from same chain:
(mouse over for more information)
d1eima4