Lineage for d1eeeb_ (1eee B:)

  1. Root: SCOPe 2.08
  2. Class b: All beta proteins [48724] (180 folds)
  3. Fold b.70: 8-bladed beta-propeller [50997] (3 superfamilies)
    consists of eight 4-stranded beta-sheet motifs; meander
    also found in some members of the WD40-repeat superfamily
  4. Superfamily b.70.1: Quinoprotein alcohol dehydrogenase-like [50998] (2 families) (S)
  5. Family b.70.1.1: Quinoprotein alcohol dehydrogenase-like [50999] (4 proteins)
  6. Protein Ethanol dehydrogenase [51002] (1 species)
  7. Species Pseudomonas aeruginosa [TaxId:287] [51003] (2 PDB entries)
  8. Domain d1eeeb_: 1eee B: [302381]
    automated match to d1flga_
    complexed with ca, na, pqq

Details for d1eeeb_

PDB Entry: 1eee (more details), 2.6 Å

PDB Description: crystal structure of the quinoprotein ethanol dehydrogenase from pseudomonas aeruginosa
PDB Compounds: (B:) quinoprotein ethanol dehydrogenase

SCOPe Domain Sequences for d1eeeb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1eeeb_ b.70.1.1 (B:) Ethanol dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]}
kdvtwedianddkttgdvlqygmgthaqrwsplkqvnadnvfkltpawsysfgdekqrgq
esqaivsdgviyvtasysrlfaldaktgkrlwtynhrlpddirpccdvvnrgaaiygdkv
ffgtldasvvalnkntgkvvwkkkfadhgagytmtgaptivkdgktgkvllihgssgdef
gvvgrlfardpdtgeeiwmrpfveghmgrlngkdstvtgdvkapswpddrnsptgkvesw
shgggapwqsasfdaetntiivgagnpgpwntwartakggnphdydslytsgqvgvdpss
gevkwfyqhtpndawdfsgnnelvlfdykakdgkivkatahadrngffyvvdrsngklqn
afpfvdnitwashidlktgrpveregqrpplpepgqkhgkavevsppflggknwnpmays
qdtglfyvpanhwkedywteevsytkgsaylgmgfrikrmyddhvgslramdpvsgkvvw
ehkehlplwagvlatagnlvftgtgdgyfkafdaksgkelwkfqtgsgivsppitweqdg
eqylgvtvgyggavplwggdmadltrpvaqggsfwvfklpsw

SCOPe Domain Coordinates for d1eeeb_ are not available.

Timeline for d1eeeb_:

Domains from other chains:
(mouse over for more information)
d1eeea_