Lineage for d1eeea_ (1eee A:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2066579Fold b.70: 8-bladed beta-propeller [50997] (3 superfamilies)
    consists of eight 4-stranded beta-sheet motifs; meander
    also found in some members of the WD40-repeat superfamily
  4. 2066580Superfamily b.70.1: Quinoprotein alcohol dehydrogenase-like [50998] (2 families) (S)
  5. 2066581Family b.70.1.1: Quinoprotein alcohol dehydrogenase-like [50999] (4 protein domains)
  6. 2066582Protein Ethanol dehydrogenase [51002] (1 species)
  7. 2066583Species Pseudomonas aeruginosa [TaxId:287] [51003] (2 PDB entries)
  8. 2066584Domain d1eeea_: 1eee A: [302380]
    automated match to d1flga_
    complexed with ca, na, pqq

Details for d1eeea_

PDB Entry: 1eee (more details), 2.6 Å

PDB Description: crystal structure of the quinoprotein ethanol dehydrogenase from pseudomonas aeruginosa
PDB Compounds: (A:) quinoprotein ethanol dehydrogenase

SCOPe Domain Sequences for d1eeea_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1eeea_ b.70.1.1 (A:) Ethanol dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]}
kdvtwedianddkttgdvlqygmgthaqrwsplkqvnadnvfkltpawsysfgdekqrgq
esqaivsdgviyvtasysrlfaldaktgkrlwtynhrlpddirpccdvvnrgaaiygdkv
ffgtldasvvalnkntgkvvwkkkfadhgagytmtgaptivkdgktgkvllihgssgdef
gvvgrlfardpdtgeeiwmrpfveghmgrlngkdstvtgdvkapswpddrnsptgkvesw
shgggapwqsasfdaetntiivgagnpgpwntwartakggnphdydslytsgqvgvdpss
gevkwfyqhtpndawdfsgnnelvlfdykakdgkivkatahadrngffyvvdrsngklqn
afpfvdnitwashidlktgrpveregqrpplpepgqkhgkavevsppflggknwnpmays
qdtglfyvpanhwkedywteevsytkgsaylgmgfrikrmyddhvgslramdpvsgkvvw
ehkehlplwagvlatagnlvftgtgdgyfkafdaksgkelwkfqtgsgivsppitweqdg
eqylgvtvgyggavplwggdmadltrpvaqggsfwvfklpsw

SCOPe Domain Coordinates for d1eeea_:

Click to download the PDB-style file with coordinates for d1eeea_.
(The format of our PDB-style files is described here.)

Timeline for d1eeea_:

  • d1eeea_ is new in SCOPe 2.06-stable