SCOPe 2.08: Domain d1eckb2: 1eck B:122-156

Lineage for d1eckb2 (1eck B:122-156)

1. Root: SCOPe 2.08

2. Class g: Small proteins [56992] (100 folds)

3. Fold g.41: Rubredoxin-like [57769] (17 superfamilies)
   metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2

4. Superfamily g.41.2: Microbial and mitochondrial ADK, insert 'zinc finger' domain [57774] (2 families)
   automatically mapped to Pfam PF05191

5. Family g.41.2.1: Microbial and mitochondrial ADK, insert 'zinc finger' domain [57775] (1 protein)

6. Protein Microbial and mitochondrial ADK, insert 'zinc finger' domain [57776] (9 species)

7. Species Escherichia coli [TaxId:562] [57778] (10 PDB entries)
   contains a rudiment form of the domain that lacks zn-binding site

8. Domain d1eckb2: 1eck B:122-156 [302379]
   Other proteins in same PDB: d1ecka1, d1eckb1
   automated match to d1akea2
   complexed with adp, amp

Details for d1eckb2

PDB Entry: 1eck, 2.8 Å

PDB Description: adenylate kinase with bound amp and adp

PDB Compounds: (B:) adenylate kinase

SCOPe Domain Sequences for d1eckb2:

Sequence; same for both SEQRES and ATOM records:

>d1eckb2 g.41.2.1 (B:122-156) Microbial and mitochondrial ADK, insert 'zinc finger' domain {Escherichia coli [TaxId: 562]}
grrvhapsgrvyhvkfnppkvegkddvtgeelttr

Timeline for d1eckb2:

• d1eckb2 first appeared in SCOPe 2.06
  
• d1eckb2 appears in SCOPe 2.07