Lineage for d1ecka1 (1eck A:1-121,A:157-214)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2473887Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2473888Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2473889Family c.37.1.1: Nucleotide and nucleoside kinases [52541] (21 proteins)
    parallel beta-sheet of 5 strands, order 23145
  6. 2473894Protein Adenylate kinase [52554] (16 species)
  7. 2473918Species Escherichia coli [TaxId:562] [52560] (9 PDB entries)
    contains a rudiment "zinc-finger" subdomain, residue 122-156
  8. 2473932Domain d1ecka1: 1eck A:1-121,A:157-214 [302376]
    Other proteins in same PDB: d1ecka2, d1eckb2
    automated match to d1akea1
    complexed with adp, amp

Details for d1ecka1

PDB Entry: 1eck (more details), 2.8 Å

PDB Description: adenylate kinase with bound amp and adp
PDB Compounds: (A:) adenylate kinase

SCOPe Domain Sequences for d1ecka1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ecka1 c.37.1.1 (A:1-121,A:157-214) Adenylate kinase {Escherichia coli [TaxId: 562]}
mriillgapgagkgtqaqfimekygipqistgdmlraavksgselgkqakdimdagklvt
delvialvkeriaqedcrngflldgfprtipqadamkeaginvdyvlefdvpdelivdri
vXkddqeetvrkrlveyhqmtapligyyskeaeagntkyakvdgtkpvaevradlekilg

SCOPe Domain Coordinates for d1ecka1:

Click to download the PDB-style file with coordinates for d1ecka1.
(The format of our PDB-style files is described here.)

Timeline for d1ecka1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ecka2