Lineage for d1e53a_ (1e53 A:)

  1. Root: SCOPe 2.07
  2. 2581248Class g: Small proteins [56992] (98 folds)
  3. 2588840Fold g.49: Cysteine-rich domain [57888] (1 superfamily)
    dimetal(zinc)-bound alpha+beta fold
  4. 2588841Superfamily g.49.1: Cysteine-rich domain [57889] (4 families) (S)
  5. 2588882Family g.49.1.2: TFIIH p44 subunit cysteine-rich domain [57899] (2 proteins)
  6. 2588886Protein automated matches [310837] (1 species)
    not a true protein
  7. 2588887Species Homo sapiens [311132] (1 PDB entry)
  8. 2588888Domain d1e53a_: 1e53 A: [302369]
    automated match to d1z60a1
    complexed with zn

Details for d1e53a_

PDB Entry: 1e53 (more details)

PDB Description: carboxy-terminal domain of human tfiih p44 subunit
PDB Compounds: (A:) tfiih p44 subunit

SCOPe Domain Sequences for d1e53a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1e53a_ g.49.1.2 (A:) automated matches {Homo sapiens}
ldafqeipleeyngerfcygcqgelkdqhvyvcavcqnvfcvdcdvfvhdslhccpgci

SCOPe Domain Coordinates for d1e53a_:

Click to download the PDB-style file with coordinates for d1e53a_.
(The format of our PDB-style files is described here.)

Timeline for d1e53a_: