Lineage for d1e3nb_ (1e3n B:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2935697Fold d.17: Cystatin-like [54402] (7 superfamilies)
    Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet
  4. 2936287Superfamily d.17.4: NTF2-like [54427] (31 families) (S)
    has a beta-alpha(2)-beta insertion after the main helix
  5. 2936379Family d.17.4.3: Ketosteroid isomerase-like [54434] (3 proteins)
    automatically mapped to Pfam PF12680
    automatically mapped to Pfam PF02136
  6. 2936380Protein Delta-5-3-ketosteroid isomerase, steroid delta-isomerase, KSI [54435] (3 species)
  7. 2936462Species Pseudomonas putida [TaxId:303] [54437] (61 PDB entries)
    Uniprot P07445
  8. 2936536Domain d1e3nb_: 1e3n B: [302368]
    automated match to d1ogxa_
    complexed with equ; mutant

Details for d1e3nb_

PDB Entry: 1e3n (more details), 2 Å

PDB Description: high resolution crystal structure of pi ketosteroid isomerase mutant d40n(d38n, ti numbering) complexed with equilenin at 2.0 a resolution.
PDB Compounds: (B:) isomerase

SCOPe Domain Sequences for d1e3nb_:

Sequence, based on SEQRES records: (download)

>d1e3nb_ d.17.4.3 (B:) Delta-5-3-ketosteroid isomerase, steroid delta-isomerase, KSI {Pseudomonas putida [TaxId: 303]}
nlptaqevqglmaryielvdvgdieaivqmyaddatvenpfgqppihgreqiaafyrqgl
gggkvracltgpvrashngcgampfrvemvwngqpcaldvidvmrfdehgriqtmqayws
evnlsv

Sequence, based on observed residues (ATOM records): (download)

>d1e3nb_ d.17.4.3 (B:) Delta-5-3-ketosteroid isomerase, steroid delta-isomerase, KSI {Pseudomonas putida [TaxId: 303]}
nlptaqevqglmaryielvdvgdieaivqmyaddatvenpfgqppihgreqiaafyrqgl
gkvracltgpvrashngcgampfrvemvwngqpcaldvidvmrfdehgriqtmqaywsev
nlsv

SCOPe Domain Coordinates for d1e3nb_:

Click to download the PDB-style file with coordinates for d1e3nb_.
(The format of our PDB-style files is described here.)

Timeline for d1e3nb_: