Lineage for d1e2cc_ (1e2c C:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2938974Fold d.20: UBC-like [54494] (1 superfamily)
    alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2
  4. 2938975Superfamily d.20.1: UBC-like [54495] (5 families) (S)
  5. 2938976Family d.20.1.1: UBC-related [54496] (7 proteins)
  6. 2938984Protein Ubiquitin conjugating enzyme, UBC [54497] (34 species)
  7. 2939019Species Clam (Spisula solidissima), E-2C [TaxId:6584] [54504] (2 PDB entries)
  8. 2939023Domain d1e2cc_: 1e2c C: [302366]
    automated match to d2e2ca_

Details for d1e2cc_

PDB Entry: 1e2c (more details), 2 Å

PDB Description: destruction of mitotic cyclins
PDB Compounds: (C:) ubiquitin conjugating enzyme

SCOPe Domain Sequences for d1e2cc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1e2cc_ d.20.1.1 (C:) Ubiquitin conjugating enzyme, UBC {Clam (Spisula solidissima), E-2C [TaxId: 6584]}
mttskerhsvskrlqqelrtllmsgdpgitafpdgdnlfkwvatldgpkdtvyeslkykl
tlefpsdypykppvvkfttpcwhpnvdqsgnicldilkenwtasydvrtillslqsllge
pnnasplnaqaadmwsnqteykkvlhekyktaqsdk

SCOPe Domain Coordinates for d1e2cc_:

Click to download the PDB-style file with coordinates for d1e2cc_.
(The format of our PDB-style files is described here.)

Timeline for d1e2cc_: