![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.20: UBC-like [54494] (1 superfamily) alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2 |
![]() | Superfamily d.20.1: UBC-like [54495] (5 families) ![]() |
![]() | Family d.20.1.1: UBC-related [54496] (7 proteins) |
![]() | Protein Ubiquitin conjugating enzyme, UBC [54497] (34 species) |
![]() | Species Clam (Spisula solidissima), E-2C [TaxId:6584] [54504] (2 PDB entries) |
![]() | Domain d1e2cb_: 1e2c B: [302365] automated match to d2e2ca_ |
PDB Entry: 1e2c (more details), 2 Å
SCOPe Domain Sequences for d1e2cb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1e2cb_ d.20.1.1 (B:) Ubiquitin conjugating enzyme, UBC {Clam (Spisula solidissima), E-2C [TaxId: 6584]} mttskerhsvskrlqqelrtllmsgdpgitafpdgdnlfkwvatldgpkdtvyeslkykl tlefpsdypykppvvkfttpcwhpnvdqsgnicldilkenwtasydvrtillslqsllge pnnasplnaqaadmwsnqteykkvlhekyktaqsdk
Timeline for d1e2cb_: