Lineage for d1e1ba2 (1e1b A:90-187)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3001353Fold d.169: C-type lectin-like [56435] (1 superfamily)
    unusual fold
  4. 3001354Superfamily d.169.1: C-type lectin-like [56436] (9 families) (S)
  5. 3002026Family d.169.1.3: Invasin/intimin cell-adhesion fragment, C-terminal domain [56472] (2 proteins)
    automatically mapped to Pfam PF07979
  6. 3002027Protein Intimin [56473] (1 species)
  7. 3002028Species Escherichia coli [TaxId:562] [56474] (4 PDB entries)
    an enteropathogenic serotype
  8. 3002032Domain d1e1ba2: 1e1b A:90-187 [302363]
    Other proteins in same PDB: d1e1ba1
    automated match to d1f00i3

Details for d1e1ba2

PDB Entry: 1e1b (more details)

PDB Description: nmr representative structure of intimin-190 (int190) from enteropathogenic e. coli
PDB Compounds: (A:) intimin

SCOPe Domain Sequences for d1e1ba2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1e1ba2 d.169.1.3 (A:90-187) Intimin {Escherichia coli [TaxId: 562]}
livpnmskrvtyndavntcknfggklpssqnelenvfkawgaankyeyykssqtiiswvq
qtaqdaksgvastydlvkqnplnnikasesnayatcvk

SCOPe Domain Coordinates for d1e1ba2:

Click to download the PDB-style file with coordinates for d1e1ba2.
(The format of our PDB-style files is described here.)

Timeline for d1e1ba2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1e1ba1