Lineage for d1e1ba1 (1e1b A:1-89)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2017115Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2031983Superfamily b.1.14: Invasin/intimin cell-adhesion fragments [49373] (2 families) (S)
  5. 2031984Family b.1.14.1: Invasin/intimin cell-adhesion fragments [49374] (2 protein domains)
  6. 2031985Protein Intimin [49375] (1 species)
  7. 2031986Species Escherichia coli [TaxId:562] [49376] (4 PDB entries)
    an enteropathogenic serotype
  8. 2031992Domain d1e1ba1: 1e1b A:1-89 [302362]
    Other proteins in same PDB: d1e1ba2
    automated match to d1f00i2

Details for d1e1ba1

PDB Entry: 1e1b (more details)

PDB Description: nmr representative structure of intimin-190 (int190) from enteropathogenic e. coli
PDB Compounds: (A:) intimin

SCOPe Domain Sequences for d1e1ba1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1e1ba1 b.1.14.1 (A:1-89) Intimin {Escherichia coli [TaxId: 562]}
tltiddgnieivgtgvkgklptvwlqygqvnlkasggngkytwrsanpaiasvdassgqv
tlkekgtttisvissdnqtatytiatpns

SCOPe Domain Coordinates for d1e1ba1:

Click to download the PDB-style file with coordinates for d1e1ba1.
(The format of our PDB-style files is described here.)

Timeline for d1e1ba1:

  • d1e1ba1 is new in SCOPe 2.06-stable

View in 3D
Domains from same chain:
(mouse over for more information)
d1e1ba2