SCOPe 2.08: Domain d1e1ba1: 1e1b A:1-89

Lineage for d1e1ba1 (1e1b A:1-89)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.14: Invasin/intimin cell-adhesion fragments [49373] (2 families)

5. Family b.1.14.1: Invasin/intimin cell-adhesion fragments [49374] (2 proteins)

6. Protein Intimin [49375] (1 species)

7. Species Escherichia coli [TaxId:562] [49376] (5 PDB entries)
   an enteropathogenic serotype

8. Domain d1e1ba1: 1e1b A:1-89 [302362]
   Other proteins in same PDB: d1e1ba2
   automated match to d1f00i2

Details for d1e1ba1

PDB Entry: 1e1b

PDB Description: nmr representative structure of intimin-190 (int190) from enteropathogenic e. coli

PDB Compounds: (A:) intimin

SCOPe Domain Sequences for d1e1ba1:

Sequence; same for both SEQRES and ATOM records:

>d1e1ba1 b.1.14.1 (A:1-89) Intimin {Escherichia coli [TaxId: 562]}
tltiddgnieivgtgvkgklptvwlqygqvnlkasggngkytwrsanpaiasvdassgqv
tlkekgtttisvissdnqtatytiatpns

Timeline for d1e1ba1:

• d1e1ba1 first appeared in SCOPe 2.06
  
• d1e1ba1 appears in SCOPe 2.07