SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d1e1ba1 (1e1b A:1-89)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2017115Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2031983Superfamily b.1.14: Invasin/intimin cell-adhesion fragments [49373] (2 families) (S)
  5. 2031984Family b.1.14.1: Invasin/intimin cell-adhesion fragments [49374] (2 protein domains)
  6. 2031985Protein Intimin [49375] (1 species)
  7. 2031986Species Escherichia coli [TaxId:562] [49376] (4 PDB entries)
    an enteropathogenic serotype
  8. 2031992Domain d1e1ba1: 1e1b A:1-89 [302362]
    Other proteins in same PDB: d1e1ba2
    automated match to d1f00i2

Details for d1e1ba1

PDB Entry: 1e1b (more details)

PDB Description: nmr representative structure of intimin-190 (int190) from enteropathogenic e. coli
PDB Compounds: (A:) intimin

SCOPe Domain Sequences for d1e1ba1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1e1ba1 b.1.14.1 (A:1-89) Intimin {Escherichia coli [TaxId: 562]}
tltiddgnieivgtgvkgklptvwlqygqvnlkasggngkytwrsanpaiasvdassgqv
tlkekgtttisvissdnqtatytiatpns

SCOPe Domain Coordinates for d1e1ba1:

Click to download the PDB-style file with coordinates for d1e1ba1.
(The format of our PDB-style files is described here.)

Timeline for d1e1ba1:

  • d1e1ba1 is new in SCOPe 2.06-stable

View in 3D
Domains from same chain:
(mouse over for more information)
d1e1ba2