Lineage for d1e13a1 (1e13 A:104-171)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2782725Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 2785033Superfamily b.34.13: Chromo domain-like [54160] (4 families) (S)
    SH3-like barrel is capped by a C-terminal helix
  5. 2785079Family b.34.13.2: Chromo domain [54165] (8 proteins)
    lacks the SH3-like barrel first strand that can be complemented by bound peptide ligand; in shadow chromo domain the corresponding site is altered by insertion; similarity to the IL8-like fold
  6. 2785156Protein automated matches [191035] (3 species)
    not a true protein
  7. 2785183Species Mouse (Mus musculus) [TaxId:10090] [255382] (5 PDB entries)
  8. 2785193Domain d1e13a1: 1e13 A:104-171 [302358]
    Other proteins in same PDB: d1e13a2, d1e13b2
    automated match to d1s4za_

Details for d1e13a1

PDB Entry: 1e13 (more details)

PDB Description: mouse hp1 (m31) c terminal (shadow chromo) domain
PDB Compounds: (A:) modifier 1 protein

SCOPe Domain Sequences for d1e13a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1e13a1 b.34.13.2 (A:104-171) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
keesekprgfargleperiigatdssgelmflmkwknsdeadlvpakeanvkcpqvvisf
yeerltwh

SCOPe Domain Coordinates for d1e13a1:

Click to download the PDB-style file with coordinates for d1e13a1.
(The format of our PDB-style files is described here.)

Timeline for d1e13a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1e13a2