| Class g: Small proteins [56992] (100 folds) |
| Fold g.41: Rubredoxin-like [57769] (17 superfamilies) metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2 |
Superfamily g.41.6: Hypothetical protein MTH1184 [57821] (1 family) ![]() contains two CXC motifs automatically mapped to Pfam PF09082 |
| Family g.41.6.1: Hypothetical protein MTH1184 [57822] (1 protein) possible metal-binding fold |
| Protein Hypothetical protein MTH1184 [57823] (1 species) |
| Species Methanobacterium thermoautotrophicum [TaxId:145262] [57824] (2 PDB entries) |
| Domain d1dw7a_: 1dw7 A: [302354] automated match to d1gh9a_ |
PDB Entry: 1dw7 (more details)
SCOPe Domain Sequences for d1dw7a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1dw7a_ g.41.6.1 (A:) Hypothetical protein MTH1184 {Methanobacterium thermoautotrophicum [TaxId: 145262]}
myiifrcdcgralysregaktrkcvcgrtvnvkdrrifgraddfeeaselvrklqeekyg
schftnpskre
Timeline for d1dw7a_: