Lineage for d1dw7a_ (1dw7 A:)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3036286Fold g.41: Rubredoxin-like [57769] (17 superfamilies)
    metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2
  4. 3036839Superfamily g.41.6: Hypothetical protein MTH1184 [57821] (1 family) (S)
    contains two CXC motifs
    automatically mapped to Pfam PF09082
  5. 3036840Family g.41.6.1: Hypothetical protein MTH1184 [57822] (1 protein)
    possible metal-binding fold
  6. 3036841Protein Hypothetical protein MTH1184 [57823] (1 species)
  7. 3036842Species Methanobacterium thermoautotrophicum [TaxId:145262] [57824] (2 PDB entries)
  8. 3036843Domain d1dw7a_: 1dw7 A: [302354]
    automated match to d1gh9a_

Details for d1dw7a_

PDB Entry: 1dw7 (more details)

PDB Description: solution structure of a 8.3 kda protein (gene mth1184) from methanobacterium thermoautotrophicum
PDB Compounds: (A:) 8.3 kda protein (gene mth1184)

SCOPe Domain Sequences for d1dw7a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dw7a_ g.41.6.1 (A:) Hypothetical protein MTH1184 {Methanobacterium thermoautotrophicum [TaxId: 145262]}
myiifrcdcgralysregaktrkcvcgrtvnvkdrrifgraddfeeaselvrklqeekyg
schftnpskre

SCOPe Domain Coordinates for d1dw7a_:

Click to download the PDB-style file with coordinates for d1dw7a_.
(The format of our PDB-style files is described here.)

Timeline for d1dw7a_: