Lineage for d1du7a4 (1du7 A:68-208)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2008141Fold a.121: Tetracyclin repressor-like, C-terminal domain [48497] (1 superfamily)
    multihelical; interlocked (homo)dimer
  4. 2008142Superfamily a.121.1: Tetracyclin repressor-like, C-terminal domain [48498] (2 families) (S)
  5. 2008143Family a.121.1.1: Tetracyclin repressor-like, C-terminal domain [48499] (35 protein domains)
  6. 2008349Protein Tetracyclin repressor (Tet-repressor, TetR) [48500] (1 species)
  7. 2008350Species Escherichia coli [TaxId:562] [48501] (28 PDB entries)
  8. 2008378Domain d1du7a4: 1du7 A:68-208 [302353]
    Other proteins in same PDB: d1du7a3
    automated match to d1bjza2
    protein/DNA complex; complexed with ctc

Details for d1du7a4

PDB Entry: 1du7 (more details), 2.51 Å

PDB Description: crystal structure of tet repressor class d with 4-epi-tetracycline
PDB Compounds: (A:) protein (tetracycline repressor protein class d)

SCOPe Domain Sequences for d1du7a4:

Sequence, based on SEQRES records: (download)

>d1du7a4 a.121.1.1 (A:68-208) Tetracyclin repressor (Tet-repressor, TetR) {Escherichia coli [TaxId: 562]}
lpaageswqsflrnnamsfrrallryrdgakvhlgtrpdekqydtvetqlrfmtengfsl
rdglyaisavshftlgavleqqehtaaltdrpaapdenlppllrealqimdsddgeqafl
hgleslirgfevqltallqiv

Sequence, based on observed residues (ATOM records): (download)

>d1du7a4 a.121.1.1 (A:68-208) Tetracyclin repressor (Tet-repressor, TetR) {Escherichia coli [TaxId: 562]}
lpaageswqsflrnnamsfrrallryrdgakvhlgtrpdekqydtvetqlrfmtengfsl
rdglyaisavshftlgavleqqehtadenlppllrealqimdsddgeqaflhgleslirg
fevqltallqiv

SCOPe Domain Coordinates for d1du7a4:

Click to download the PDB-style file with coordinates for d1du7a4.
(The format of our PDB-style files is described here.)

Timeline for d1du7a4:

  • d1du7a4 is new in SCOPe 2.06-stable

View in 3D
Domains from same chain:
(mouse over for more information)
d1du7a3