| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.1: Homeodomain-like [46689] (21 families) ![]() consists only of helices |
| Family a.4.1.9: Tetracyclin repressor-like, N-terminal domain [46764] (35 proteins) |
| Protein Tetracyclin repressor (Tet-repressor, TetR) [46765] (1 species) |
| Species Escherichia coli [TaxId:562] [46766] (36 PDB entries) |
| Domain d1du7a3: 1du7 A:2-67 [302352] Other proteins in same PDB: d1du7a4 automated match to d1bjza1 protein/DNA complex; complexed with ctc |
PDB Entry: 1du7 (more details), 2.51 Å
SCOPe Domain Sequences for d1du7a3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1du7a3 a.4.1.9 (A:2-67) Tetracyclin repressor (Tet-repressor, TetR) {Escherichia coli [TaxId: 562]}
srlnresvidaalellnetgidglttrklaqklgieqptlywhvknkralldalaveila
rhhdys
Timeline for d1du7a3: