Lineage for d1dooe_ (1doo E:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2865683Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2865684Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) (S)
    division into families based on beta-sheet topologies
  5. 2870969Family c.37.1.20: Extended AAA-ATPase domain [81269] (43 proteins)
    fold is similar to that of RecA, but lacks the last two strands, followed by a family-specific Arg-finger domain
  6. 2871110Protein HslU [52721] (2 species)
    ATPase subunit of ATP-dependent protease
  7. 2871111Species Escherichia coli [TaxId:562] [52722] (11 PDB entries)
  8. 2871115Domain d1dooe_: 1doo E: [302349]
    Other proteins in same PDB: d1dooa_, d1doob_, d1dooc_, d1dood_
    automated match to d1do0a_
    complexed with anp

    has additional subdomain(s) that are not in the common domain

Details for d1dooe_

PDB Entry: 1doo (more details), 2.81 Å

PDB Description: heat shock locus v (hslv)-heat shock locus u (hslu) from e. coli
PDB Compounds: (E:) protein (heat shock locus u)

SCOPe Domain Sequences for d1dooe_:

Sequence, based on SEQRES records: (download)

>d1dooe_ c.37.1.20 (E:) HslU {Escherichia coli [TaxId: 562]}
semtpreivseldkhiigqdnakrsvaialrnrwrrmqlneelrhevtpknilmigptgv
gkteiarrlaklanapfikveatkftevgyvgkevdsiirdltdaavkmvrvqaieknry
raeelaeerildvlippaknnwgqteqqqepsaarqafrkklregqlddkeieidlaaap
mgveimappgmeemtsqlqsmfqnlggqkqkarklkikdamkllieeeaaklvnpeelkq
daidaveqhgivfideidkickrgessgpdvsregvqrdllplvegctvstkhgmvktdh
ilfiasgafqiakpsdlipelqgrlpirvelqalttsdferiltepnasitvqykalmat
egvnieftdsgikriaeaawqvnestenigarrlhtvlerlmeeisydasdlsgqnitid
adyvskhldalvadedlsrfil

Sequence, based on observed residues (ATOM records): (download)

>d1dooe_ c.37.1.20 (E:) HslU {Escherichia coli [TaxId: 562]}
semtpreivseldkhiigqdnakrsvaialrnrwrrmqlneelrhevtpknilmigptgv
gkteiarrlaklanapfikveatkftevgyvgkevdsiirdltdaavkmvrvqaieknry
raeelaeerildvlippaknnwgqteqqqepsaarqafrkklreglkikdamkllieeea
aklvnpeelkqdaidaveqhgivfideidkickrgessgpdvsregvqrdllplvegctv
stkhgmvktdhilfiasgafqiakpsdlipelqgrlpirvelqalttsdferiltepnas
itvqykalmategvnieftdsgikriaeaawqvnestenigarrlhtvlerlmeeisyda
sdlsgqnitidadyvskhldalvadedlsrfil

SCOPe Domain Coordinates for d1dooe_:

Click to download the PDB-style file with coordinates for d1dooe_.
(The format of our PDB-style files is described here.)

Timeline for d1dooe_: