Lineage for d1dooc_ (1doo C:)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. Family d.153.1.4: Proteasome subunits [56251] (4 proteins)
  6. Protein automated matches [190144] (14 species)
    not a true protein
  7. Species Escherichia coli [311130] (1 PDB entry)
  8. Domain d1dooc_: 1doo C: [302347]
    Other proteins in same PDB: d1dooe_, d1doof_
    automated match to d1g4aa_
    complexed with anp

Details for d1dooc_

PDB Entry: 1doo (more details), 2.81 Å

PDB Description: heat shock locus v (hslv)-heat shock locus u (hslu) from e. coli
PDB Compounds: (C:) protein (heat shock locus v)

SCOPe Domain Sequences for d1dooc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dooc_ d.153.1.4 (C:) automated matches {Escherichia coli}
ttivsvrrnghvviagdgqatlgntvmkgnvkkvrrlyndkviagfaggtadaftlfelf
erklemhqghlvkaavelakdwrtdrmlrkleallavadetasliitgngdvvqpendli
aigsggpyaqaaarallentelsareiaekaldiagdiciytnhfhtieelsy

SCOPe Domain Coordinates for d1dooc_ are not available.

Timeline for d1dooc_:

Domains from other chains:
(mouse over for more information)
d1dooa_, d1doob_, d1dood_, d1dooe_, d1doof_