Lineage for d1doob_ (1doo B:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2548740Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 2548741Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 2548925Family d.153.1.4: Proteasome subunits [56251] (4 proteins)
  6. 2552691Protein automated matches [190144] (11 species)
    not a true protein
  7. 2554144Species Escherichia coli [311130] (1 PDB entry)
  8. 2554146Domain d1doob_: 1doo B: [302346]
    Other proteins in same PDB: d1dooe_, d1doof_
    automated match to d1g4aa_
    complexed with anp

Details for d1doob_

PDB Entry: 1doo (more details), 2.81 Å

PDB Description: heat shock locus v (hslv)-heat shock locus u (hslu) from e. coli
PDB Compounds: (B:) protein (heat shock locus v)

SCOPe Domain Sequences for d1doob_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1doob_ d.153.1.4 (B:) automated matches {Escherichia coli}
ttivsvrrnghvviagdgqatlgntvmkgnvkkvrrlyndkviagfaggtadaftlfelf
erklemhqghlvkaavelakdwrtdrmlrkleallavadetasliitgngdvvqpendli
aigsggpyaqaaarallentelsareiaekaldiagdiciytnhfhtieelsy

SCOPe Domain Coordinates for d1doob_:

Click to download the PDB-style file with coordinates for d1doob_.
(The format of our PDB-style files is described here.)

Timeline for d1doob_: