Lineage for d1dn1b_ (1dn1 B:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2323361Fold a.47: STAT-like [47654] (6 superfamilies)
    4 long helices; bundle, left-handed twist (coiled coil); right-handed superhelix
  4. 2323374Superfamily a.47.2: t-snare proteins [47661] (1 family) (S)
  5. 2323375Family a.47.2.1: t-snare proteins [47662] (6 protein domains)
  6. 2323399Protein automated matches [191190] (5 species)
    not a true protein
  7. 2323413Species Rattus norvegicus [311131] (1 PDB entry)
  8. 2323414Domain d1dn1b_: 1dn1 B: [302344]
    Other proteins in same PDB: d1dn1a_
    automated match to d3c98b_

Details for d1dn1b_

PDB Entry: 1dn1 (more details), 2.6 Å

PDB Description: Crystal structure of the neuronal-sec1/syntaxin 1a complex
PDB Compounds: (B:) syntaxin 1a

SCOPe Domain Sequences for d1dn1b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dn1b_ a.47.2.1 (B:) automated matches {Rattus norvegicus}
drfmdeffeqveeirgfidkiaenveevkrkhsailaspnpdektkeeleelmsdikkta
nkvrsklksieqsieqeeglnrssadlrirktqhstlsrkfvevmseynatqsdyrerck
griqrqleitgrtttseeledmlesgnpaifasgiimdssiskqalseietrhseiikle
nsirelhdmfmdmamlvesqgemidrieynvehavdyverav

SCOPe Domain Coordinates for d1dn1b_:

Click to download the PDB-style file with coordinates for d1dn1b_.
(The format of our PDB-style files is described here.)

Timeline for d1dn1b_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1dn1a_