SCOPe 2.08: Domain d1dkva6: 1dkv A:514-700

Lineage for d1dkva6 (1dkv A:514-700)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.39: EF Hand-like [47472] (4 superfamilies)
   core: 4 helices; array of 2 hairpins, opened

4. Superfamily a.39.1: EF-hand [47473] (12 families)
   Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop

5. Family a.39.1.0: automated matches [191396] (1 protein)
   not a true family

6. Protein automated matches [190513] (36 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [189519] (58 PDB entries)

8. Domain d1dkva6: 1dkv A:514-700 [302340]
   Other proteins in same PDB: d1dkva4, d1dkva5, d1dkvb_
   automated match to d1qxpa2

Details for d1dkva6

PDB Entry: 1dkv, 2.3 Å

PDB Description: the crystal structure of calcium-free human m-calpain

PDB Compounds: (A:) m-calpain

SCOPe Domain Sequences for d1dkva6:

Sequence; same for both SEQRES and ATOM records:

>d1dkva6 a.39.1.0 (A:514-700) automated matches {Human (Homo sapiens) [TaxId: 9606]}
deieanleefdiseddiddgvrrlfaqlagedaeisafelqtilrrvlakrqdiksdgfs
ietckimvdmldsdgsgklglkefyilwtkiqkyqkiyreidvdrsgtmnsyemrkalee
agfkmpcqlhqvivarfaddqliidfdnfvrclvrletlfkifkqldpentgtieldlis
wlcfsvl

Timeline for d1dkva6:

• d1dkva6 first appeared in SCOPe 2.06
  
• d1dkva6 appears in SCOPe 2.07