Lineage for d1dkva5 (1dkv A:356-513)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2773820Fold b.14: Calpain large subunit, middle domain (domain III) [49757] (1 superfamily)
    sandwich; 8 strands in 2 sheets; jelly-roll
  4. 2773821Superfamily b.14.1: Calpain large subunit, middle domain (domain III) [49758] (2 families) (S)
    automatically mapped to Pfam PF01067
  5. 2773833Family b.14.1.0: automated matches [310664] (1 protein)
    not a true family
  6. 2773834Protein automated matches [310836] (1 species)
    not a true protein
  7. 2773835Species Homo sapiens [311129] (1 PDB entry)
  8. 2773836Domain d1dkva5: 1dkv A:356-513 [302339]
    Other proteins in same PDB: d1dkva4, d1dkva6, d1dkvb_
    automated match to d1qxpa3

Details for d1dkva5

PDB Entry: 1dkv (more details), 2.3 Å

PDB Description: the crystal structure of calcium-free human m-calpain
PDB Compounds: (A:) m-calpain

SCOPe Domain Sequences for d1dkva5:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dkva5 b.14.1.0 (A:356-513) automated matches {Homo sapiens}
wkltkmdgnwrrgstaggcrnypntfwmnpqylikleeededeedgesgctflvgliqkh
rrrqrkmgedmhtigfgiyevpeelsgqtnlhlsknffltnrarersdtfinlrevlnrf
klppgeyilvpstfepnkdgdfcirvfsekkadyqavd

SCOPe Domain Coordinates for d1dkva5:

Click to download the PDB-style file with coordinates for d1dkva5.
(The format of our PDB-style files is described here.)

Timeline for d1dkva5:

View in 3D
Domains from other chains:
(mouse over for more information)
d1dkvb_