SCOPe 2.08: Domain d1dkva4: 1dkv A:2-355

Lineage for d1dkva4 (1dkv A:2-355)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.3: Cysteine proteinases [54000] (1 superfamily)
   consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn

4. Superfamily d.3.1: Cysteine proteinases [54001] (24 families)
   the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet

5. Family d.3.1.0: automated matches [191342] (1 protein)
   not a true family

6. Protein automated matches [190230] (23 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187072] (53 PDB entries)

8. Domain d1dkva4: 1dkv A:2-355 [302338]
   Other proteins in same PDB: d1dkva5, d1dkva6, d1dkvb_
   automated match to d1qxpa4

Details for d1dkva4

PDB Entry: 1dkv, 2.3 Å

PDB Description: the crystal structure of calcium-free human m-calpain

PDB Compounds: (A:) m-calpain

SCOPe Domain Sequences for d1dkva4:

Sequence; same for both SEQRES and ATOM records:

>d1dkva4 d.3.1.0 (A:2-355) automated matches {Human (Homo sapiens) [TaxId: 9606]}
agiaaklakdreaaeglgsheraikylnqdyealrnecleagtlfqdpsfpaipsalgfk
elgpyssktrgmrwkrpteicadpqfiiggatrtdicqgalgdcwllaaiasltlneeil
arvvplnqsfqenyagifhfqfwqygewvevvvddrlptkdgellfvhsaegsefwsall
ekayakingcyealsggattegfedftgglaewyelkkpppnlfkiiqkalqkgsllgcs
iditsaadseaitfqklvkghaysvtgaeevesngslqklirirnpwgevewtgawndnc
pswntidpeererltrrhedgefwmsfsdflrhysrleicnltpdtltsdtykk

Timeline for d1dkva4:

• d1dkva4 first appeared in SCOPe 2.06
  
• d1dkva4 appears in SCOPe 2.07