SCOPe 2.06: Domain d1dgta6: 1dgt A:401-581

Lineage for d1dgta6 (1dgt A:401-581)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.60: SAM domain-like [47768] (16 superfamilies)
   4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins

4. Superfamily a.60.2: RuvA domain 2-like [47781] (7 families)
   duplication: contains two helix-hairpin-helix (HhH) motifs

5. Family a.60.2.2: NAD+-dependent DNA ligase, domain 3 [47786] (1 protein)

6. Protein NAD+-dependent DNA ligase, domain 3 [47787] (1 species)
   duplication: consists of two RuvA-like domains (four HhH motifs); also contains a zinc-finger subdomain

7. Species Thermus filiformis [TaxId:276] [47788] (3 PDB entries)

8. Domain d1dgta6: 1dgt A:401-581 [302334]
   Other proteins in same PDB: d1dgta4, d1dgta5
   automated match to d1dgsa1
   protein/DNA complex; complexed with amp, zn

Details for d1dgta6

PDB Entry: 1dgt, 2.9 Å

PDB Description: crystal structure of nad+-dependent dna ligase

PDB Compounds: (A:) DNA ligase

SCOPe Domain Sequences for d1dgta6:

Sequence; same for both SEQRES and ATOM records:

>d1dgta6 a.60.2.2 (A:401-581) NAD+-dependent DNA ligase, domain 3 {Thermus filiformis [TaxId: 276]}
rwpeacpecghrlvkegkvhrcpnplcpakrfeairhyasrkamdieglgeklierllek
glvrdvadlyhlrkedllglermgeksaqnllrqieeskhrglerllyalglpgvgevla
rnlarrfgtmdrlleasleelieveevgeltarailetlkdpafrdlvrrlkeagvsmes
k

Timeline for d1dgta6:

• d1dgta6 is new in SCOPe 2.06-stable
  
• d1dgta6 appears in SCOPe 2.07
  
• d1dgta6 appears in the current release, SCOPe 2.08