![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.60: SAM domain-like [47768] (17 superfamilies) 4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins |
![]() | Superfamily a.60.2: RuvA domain 2-like [47781] (7 families) ![]() duplication: contains two helix-hairpin-helix (HhH) motifs |
![]() | Family a.60.2.2: NAD+-dependent DNA ligase, domain 3 [47786] (1 protein) |
![]() | Protein NAD+-dependent DNA ligase, domain 3 [47787] (1 species) duplication: consists of two RuvA-like domains (four HhH motifs); also contains a zinc-finger subdomain |
![]() | Species Thermus filiformis [TaxId:276] [47788] (3 PDB entries) |
![]() | Domain d1dgta6: 1dgt A:401-581 [302334] Other proteins in same PDB: d1dgta4, d1dgta5 automated match to d1dgsa1 protein/DNA complex; complexed with amp, zn |
PDB Entry: 1dgt (more details), 2.9 Å
SCOPe Domain Sequences for d1dgta6:
Sequence; same for both SEQRES and ATOM records: (download)
>d1dgta6 a.60.2.2 (A:401-581) NAD+-dependent DNA ligase, domain 3 {Thermus filiformis [TaxId: 276]} rwpeacpecghrlvkegkvhrcpnplcpakrfeairhyasrkamdieglgeklierllek glvrdvadlyhlrkedllglermgeksaqnllrqieeskhrglerllyalglpgvgevla rnlarrfgtmdrlleasleelieveevgeltarailetlkdpafrdlvrrlkeagvsmes k
Timeline for d1dgta6: