Lineage for d1dgta5 (1dgt A:315-400)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2058098Fold b.40: OB-fold [50198] (16 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 2059387Superfamily b.40.4: Nucleic acid-binding proteins [50249] (17 families) (S)
  5. 2060278Family b.40.4.6: DNA ligase/mRNA capping enzyme postcatalytic domain [50307] (5 proteins)
  6. 2060297Protein NAD+-dependent DNA ligase [50313] (1 species)
  7. 2060298Species Thermus filiformis [TaxId:276] [50314] (3 PDB entries)
  8. 2060303Domain d1dgta5: 1dgt A:315-400 [302333]
    Other proteins in same PDB: d1dgta4, d1dgta6
    automated match to d1dgsa2
    protein/DNA complex; complexed with amp, zn

Details for d1dgta5

PDB Entry: 1dgt (more details), 2.9 Å

PDB Description: crystal structure of nad+-dependent dna ligase
PDB Compounds: (A:) DNA ligase

SCOPe Domain Sequences for d1dgta5:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dgta5 b.40.4.6 (A:315-400) NAD+-dependent DNA ligase {Thermus filiformis [TaxId: 276]}
aeeketrlldvvfqvgrtgrvtpvgvlepvfiegsevsrvtlhnesyieeldirigdwvl
vhkaggvipevlrvlkerrtgkerpi

SCOPe Domain Coordinates for d1dgta5:

Click to download the PDB-style file with coordinates for d1dgta5.
(The format of our PDB-style files is described here.)

Timeline for d1dgta5: