![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.40: OB-fold [50198] (17 superfamilies) barrel, closed or partly opened n=5, S=10 or S=8; greek-key |
![]() | Superfamily b.40.4: Nucleic acid-binding proteins [50249] (18 families) ![]() |
![]() | Family b.40.4.6: DNA ligase/mRNA capping enzyme postcatalytic domain [50307] (5 proteins) |
![]() | Protein NAD+-dependent DNA ligase [50313] (1 species) |
![]() | Species Thermus filiformis [TaxId:276] [50314] (3 PDB entries) |
![]() | Domain d1dgta5: 1dgt A:315-400 [302333] Other proteins in same PDB: d1dgta4, d1dgta6 automated match to d1dgsa2 protein/DNA complex; complexed with amp, zn |
PDB Entry: 1dgt (more details), 2.9 Å
SCOPe Domain Sequences for d1dgta5:
Sequence; same for both SEQRES and ATOM records: (download)
>d1dgta5 b.40.4.6 (A:315-400) NAD+-dependent DNA ligase {Thermus filiformis [TaxId: 276]} aeeketrlldvvfqvgrtgrvtpvgvlepvfiegsevsrvtlhnesyieeldirigdwvl vhkaggvipevlrvlkerrtgkerpi
Timeline for d1dgta5: