![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.142: ATP-grasp [56058] (2 superfamilies) Consists of two subdomains with different alpha+beta folds shares functional and structural similarities with the PIPK and protein kinase superfamilies |
![]() | Superfamily d.142.2: DNA ligase/mRNA capping enzyme, catalytic domain [56091] (6 families) ![]() has a circularly permuted topology |
![]() | Family d.142.2.2: Adenylation domain of NAD+-dependent DNA ligase [56096] (2 proteins) automatically mapped to Pfam PF01653 |
![]() | Protein Adenylation domain of NAD+-dependent DNA ligase [56097] (4 species) contains additional, N-terminal all-alpha subdomain |
![]() | Species Thermus filiformis [TaxId:276] [56099] (3 PDB entries) |
![]() | Domain d1dgta4: 1dgt A:1-314 [302332] Other proteins in same PDB: d1dgta5, d1dgta6 automated match to d1dgsa3 protein/DNA complex; complexed with amp, zn |
PDB Entry: 1dgt (more details), 2.9 Å
SCOPe Domain Sequences for d1dgta4:
Sequence; same for both SEQRES and ATOM records: (download)
>d1dgta4 d.142.2.2 (A:1-314) Adenylation domain of NAD+-dependent DNA ligase {Thermus filiformis [TaxId: 276]} mtreearrrinelrdliryhnyryyvladpeisdaeydrllrelkeleerfpefkspdsp teqvgarpleptfrpvrhptrmysldnaftyeevlafeerlereaeapslytvehkvdgl svlyyeegvwstgsgdgevgeevtqnlltiptiprrlkgvpdrlevrgevympieaflrl neeleergekvfknprnaaagslrqkdprvtakrglratfyalglglgleesglksqyel llwlkekgfpvehcyekalgaegveevyrrglaqrhalpfeadgvvlklddltlwgelgy taraprfalaykfp
Timeline for d1dgta4: