Lineage for d1dgta4 (1dgt A:1-314)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.142: ATP-grasp [56058] (2 superfamilies)
    Consists of two subdomains with different alpha+beta folds
    shares functional and structural similarities with the PIPK and protein kinase superfamilies
  4. Superfamily d.142.2: DNA ligase/mRNA capping enzyme, catalytic domain [56091] (6 families) (S)
    has a circularly permuted topology
  5. Family d.142.2.2: Adenylation domain of NAD+-dependent DNA ligase [56096] (2 proteins)
    automatically mapped to Pfam PF01653
  6. Protein Adenylation domain of NAD+-dependent DNA ligase [56097] (4 species)
    contains additional, N-terminal all-alpha subdomain
  7. Species Thermus filiformis [TaxId:276] [56099] (3 PDB entries)
  8. Domain d1dgta4: 1dgt A:1-314 [302332]
    Other proteins in same PDB: d1dgta5, d1dgta6
    automated match to d1dgsa3
    protein/DNA complex; complexed with amp, zn

Details for d1dgta4

PDB Entry: 1dgt (more details), 2.9 Å

PDB Description: crystal structure of nad+-dependent dna ligase
PDB Compounds: (A:) DNA ligase

SCOPe Domain Sequences for d1dgta4:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dgta4 d.142.2.2 (A:1-314) Adenylation domain of NAD+-dependent DNA ligase {Thermus filiformis [TaxId: 276]}
mtreearrrinelrdliryhnyryyvladpeisdaeydrllrelkeleerfpefkspdsp
teqvgarpleptfrpvrhptrmysldnaftyeevlafeerlereaeapslytvehkvdgl
svlyyeegvwstgsgdgevgeevtqnlltiptiprrlkgvpdrlevrgevympieaflrl
neeleergekvfknprnaaagslrqkdprvtakrglratfyalglglgleesglksqyel
llwlkekgfpvehcyekalgaegveevyrrglaqrhalpfeadgvvlklddltlwgelgy
taraprfalaykfp

SCOPe Domain Coordinates for d1dgta4 are not available.

Timeline for d1dgta4:

Domains from same chain:
(mouse over for more information)
d1dgta5, d1dgta6