SCOPe 2.06: Domain d1dgaa3: 1dga A:4-146

Lineage for d1dgaa3 (1dga A:4-146)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families)
   duplication contains two domains of this fold

5. Family c.55.1.1: Actin/HSP70 [53068] (8 proteins)

6. Protein Actin [53073] (8 species)

7. Species Slime mold (Dictyostelium discoideum) [TaxId:44689] [53076] (7 PDB entries)

8. Domain d1dgaa3: 1dga A:4-146 [302329]
   Other proteins in same PDB: d1dgag_
   automated match to d1nm1a1
   complexed with atp, ca, mg, so4

Details for d1dgaa3

PDB Entry: 1dga, 1.93 Å

PDB Description: structure of dictyostelium discoideum actin complexed with mg atp and human gelsolin segment 1.

PDB Compounds: (A:) protein (actin)

SCOPe Domain Sequences for d1dgaa3:

Sequence, based on SEQRES records:

>d1dgaa3 c.55.1.1 (A:4-146) Actin {Slime mold (Dictyostelium discoideum) [TaxId: 44689]}
dvqalvidngsgmckagfagddapravfpsivgrprhtgvmvgmgqkdsyvgdeaqskrg
iltlkypiehgivtnwddmekiwhhtfynelrvapeehpvllteaplnpkanrekmtqim
fetfntpamyvaiqavlslyasg

Sequence, based on observed residues (ATOM records):

>d1dgaa3 c.55.1.1 (A:4-146) Actin {Slime mold (Dictyostelium discoideum) [TaxId: 44689]}
dvqalvidngsgmckagfagddapravfpsivgrprhtgkdsyvgdeaqskrgiltlkyp
iehgivtnwddmekiwhhtfynelrvapeehpvllteaplnpkanrekmtqimfetfntp
amyvaiqavlslyasg

Timeline for d1dgaa3:

• d1dgaa3 is new in SCOPe 2.06-stable
  
• d1dgaa3 appears in SCOPe 2.07
  
• d1dgaa3 appears in the current release, SCOPe 2.08