Lineage for d1b26a1 (1b26 A:179-412)

  1. Root: SCOP 1.63
  2. 235644Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 238223Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 238224Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (10 families) (S)
  5. 239294Family c.2.1.7: Aminoacid dehydrogenase-like, C-terminal domain [51883] (8 proteins)
    extra N-terminal helix displaces the C-terminal helix (following strand 6) from its usual position creating a family nicotineamide-binding site
  6. 239295Protein Glutamate dehydrogenase [51884] (7 species)
  7. 239347Species Thermotoga maritima [TaxId:243274] [51888] (3 PDB entries)
  8. 239348Domain d1b26a1: 1b26 A:179-412 [30232]
    Other proteins in same PDB: d1b26a2, d1b26b2, d1b26c2, d1b26d2, d1b26e2, d1b26f2

Details for d1b26a1

PDB Entry: 1b26 (more details), 3 Å

PDB Description: glutamate dehydrogenase

SCOP Domain Sequences for d1b26a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1b26a1 c.2.1.7 (A:179-412) Glutamate dehydrogenase {Thermotoga maritima}
ggskgreeatgrgvkvcaglamdvlgidpkkatvavqgfgnvgqfaallisqelgskvva
vsdsrggiynpegfdveelirykkehgtvvtypkgeritneelleldvdilvpaalegai
hagnaerikakavvegangpttpeadeilsrrgilvvpdilanaggvtvsyfewvqdlqs
ffwdldqvrnalekmmkgafndvmkvkekynvdmrtaayilaidrvayatkkrg

SCOP Domain Coordinates for d1b26a1:

Click to download the PDB-style file with coordinates for d1b26a1.
(The format of our PDB-style files is described here.)

Timeline for d1b26a1: